Anti ZSCAN9 pAb (ATL-HPA059951)

Atlas Antibodies

SKU: ATL-HPA059951-25

• 

Protein Description: zinc finger and SCAN domain containing 9
Gene Name: ZSCAN9
Alternative Gene Name: PRD51, ZNF193
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078632: 31%, ENSRNOG00000001627: 29%
Entrez Gene ID: 7746
Uniprot ID: O15535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEPQHEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGETDEVTKT
• Gene Sequence: DEPQHEMVAHRHRQEVLCKEMVPLAEQTPLTLQSQPKEPQLTCDSAQKCHSIGETDEVTKT
• Gene ID - Mouse: ENSMUSG00000078632
• Gene ID - Rat: ENSRNOG00000001627
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.