Anti ZSCAN25 pAb (ATL-HPA055127)

Atlas Antibodies

SKU:
ATL-HPA055127-25
  • Immunohistochemical staining of human skeletal muscle shows distinct cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger and SCAN domain containing 25
Gene Name: ZSCAN25
Alternative Gene Name: FLJ32468, ZNF498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070420: 72%, ENSRNOG00000042213: 73%
Entrez Gene ID: 221785
Uniprot ID: Q6NSZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEEQLSQDPGDETRAFQEQA
Gene Sequence AKAVPCHRQGEQEETALCRGAWEPGIQLGPVEVKPEWGMPPGEGVQGPDPGTEEQLSQDPGDETRAFQEQA
Gene ID - Mouse ENSMUSG00000070420
Gene ID - Rat ENSRNOG00000042213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZSCAN25 pAb (ATL-HPA055127)
Datasheet Anti ZSCAN25 pAb (ATL-HPA055127) Datasheet (External Link)
Vendor Page Anti ZSCAN25 pAb (ATL-HPA055127) at Atlas Antibodies

Documents & Links for Anti ZSCAN25 pAb (ATL-HPA055127)
Datasheet Anti ZSCAN25 pAb (ATL-HPA055127) Datasheet (External Link)
Vendor Page Anti ZSCAN25 pAb (ATL-HPA055127)