Anti ZRANB2 pAb (ATL-HPA053960)

Atlas Antibodies

SKU: ATL-HPA053960-25

• 

Protein Description: zinc finger, RAN-binding domain containing 2
Gene Name: ZRANB2
Alternative Gene Name: ZIS, ZIS1, ZIS2, ZNF265
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028180: 100%, ENSRNOG00000009990: 100%
Entrez Gene ID: 9406
Uniprot ID: O95218
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS
• Gene Sequence: TKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRS
• Gene ID - Mouse: ENSMUSG00000028180
• Gene ID - Rat: ENSRNOG00000009990
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.