Anti ZPBP2 pAb (ATL-HPA053070 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053070-25

• 

Protein Description: zona pellucida binding protein 2
Gene Name: ZPBP2
Alternative Gene Name: MGC41930, ZPBPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017195: 74%, ENSRNOG00000007255: 69%
Entrez Gene ID: 124626
Uniprot ID: Q6X784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQ
• Gene Sequence: VELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQ
• Gene ID - Mouse: ENSMUSG00000017195
• Gene ID - Rat: ENSRNOG00000007255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.