Protein Description: zinc ribbon domain containing 1
Gene Name: ZNRD1
Alternative Gene Name: HTEX-6, hZR14, RPA12, tctex-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036315: 87%, ENSRNOG00000000779: 89%
Entrez Gene ID: 30834
Uniprot ID: Q9P1U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNRD1
Alternative Gene Name: HTEX-6, hZR14, RPA12, tctex-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036315: 87%, ENSRNOG00000000779: 89%
Entrez Gene ID: 30834
Uniprot ID: Q9P1U0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS |
| Documents & Links for Anti ZNRD1 pAb (ATL-HPA077979) | |
| Datasheet | Anti ZNRD1 pAb (ATL-HPA077979) Datasheet (External Link) |
| Vendor Page | Anti ZNRD1 pAb (ATL-HPA077979) at Atlas |
| Documents & Links for Anti ZNRD1 pAb (ATL-HPA077979) | |
| Datasheet | Anti ZNRD1 pAb (ATL-HPA077979) Datasheet (External Link) |
| Vendor Page | Anti ZNRD1 pAb (ATL-HPA077979) |