Anti ZNHIT3 pAb (ATL-HPA078211)

Catalog No:
ATL-HPA078211-25
$303.00
Protein Description: zinc finger HIT-type containing 3
Gene Name: ZNHIT3
Alternative Gene Name: TRIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020526: 68%, ENSRNOG00000027818: 68%
Entrez Gene ID: 9326
Uniprot ID: Q15649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSI
Gene ID - Mouse ENSMUSG00000020526
Gene ID - Rat ENSMUSG00000020526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ZNHIT3 pAb (ATL-HPA078211)
Datasheet Anti ZNHIT3 pAb (ATL-HPA078211) Datasheet (External Link)
Vendor Page Anti ZNHIT3 pAb (ATL-HPA078211) at Atlas

Documents & Links for Anti ZNHIT3 pAb (ATL-HPA078211)
Datasheet Anti ZNHIT3 pAb (ATL-HPA078211) Datasheet (External Link)
Vendor Page Anti ZNHIT3 pAb (ATL-HPA078211)