Protein Description: zinc finger HIT-type containing 3
Gene Name: ZNHIT3
Alternative Gene Name: TRIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020526: 68%, ENSRNOG00000027818: 68%
Entrez Gene ID: 9326
Uniprot ID: Q15649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNHIT3
Alternative Gene Name: TRIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020526: 68%, ENSRNOG00000027818: 68%
Entrez Gene ID: 9326
Uniprot ID: Q15649
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSI |
Gene ID - Mouse | ENSMUSG00000020526 |
Gene ID - Rat | ENSMUSG00000020526 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNHIT3 pAb (ATL-HPA078211) | |
Datasheet | Anti ZNHIT3 pAb (ATL-HPA078211) Datasheet (External Link) |
Vendor Page | Anti ZNHIT3 pAb (ATL-HPA078211) at Atlas |
Documents & Links for Anti ZNHIT3 pAb (ATL-HPA078211) | |
Datasheet | Anti ZNHIT3 pAb (ATL-HPA078211) Datasheet (External Link) |
Vendor Page | Anti ZNHIT3 pAb (ATL-HPA078211) |