Anti ZNF878 pAb (ATL-HPA052735)
Atlas Antibodies
- SKU:
- ATL-HPA052735-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF878
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031907: 38%, ENSRNOG00000020087: 38%
Entrez Gene ID: 729747
Uniprot ID: C9JN71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIHGR |
Gene Sequence | TPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIHGR |
Gene ID - Mouse | ENSMUSG00000031907 |
Gene ID - Rat | ENSRNOG00000020087 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF878 pAb (ATL-HPA052735) | |
Datasheet | Anti ZNF878 pAb (ATL-HPA052735) Datasheet (External Link) |
Vendor Page | Anti ZNF878 pAb (ATL-HPA052735) at Atlas Antibodies |
Documents & Links for Anti ZNF878 pAb (ATL-HPA052735) | |
Datasheet | Anti ZNF878 pAb (ATL-HPA052735) Datasheet (External Link) |
Vendor Page | Anti ZNF878 pAb (ATL-HPA052735) |