Anti ZNF852 pAb (ATL-HPA049885)
Atlas Antibodies
- SKU:
- ATL-HPA049885-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF852
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110277: 33%, ENSRNOG00000028504: 30%
Entrez Gene ID: 285346
Uniprot ID: Q6ZMS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLMNVLSVGKPLVSVPLLITTSELMLERSPQVWLGHLLKAWFSETDSKD |
Gene Sequence | NLMNVLSVGKPLVSVPLLITTSELMLERSPQVWLGHLLKAWFSETDSKD |
Gene ID - Mouse | ENSMUSG00000110277 |
Gene ID - Rat | ENSRNOG00000028504 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF852 pAb (ATL-HPA049885) | |
Datasheet | Anti ZNF852 pAb (ATL-HPA049885) Datasheet (External Link) |
Vendor Page | Anti ZNF852 pAb (ATL-HPA049885) at Atlas Antibodies |
Documents & Links for Anti ZNF852 pAb (ATL-HPA049885) | |
Datasheet | Anti ZNF852 pAb (ATL-HPA049885) Datasheet (External Link) |
Vendor Page | Anti ZNF852 pAb (ATL-HPA049885) |