Anti ZNF852 pAb (ATL-HPA048312)

Atlas Antibodies

SKU:
ATL-HPA048312-25
  • Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 852
Gene Name: ZNF852
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 61%, ENSRNOG00000004104: 52%
Entrez Gene ID: 285346
Uniprot ID: Q6ZMS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE
Gene Sequence YKEVEEHPPLSSSPVEHEGVLKGQKSYRCDE
Gene ID - Mouse ENSMUSG00000063488
Gene ID - Rat ENSRNOG00000004104
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF852 pAb (ATL-HPA048312)
Datasheet Anti ZNF852 pAb (ATL-HPA048312) Datasheet (External Link)
Vendor Page Anti ZNF852 pAb (ATL-HPA048312) at Atlas Antibodies

Documents & Links for Anti ZNF852 pAb (ATL-HPA048312)
Datasheet Anti ZNF852 pAb (ATL-HPA048312) Datasheet (External Link)
Vendor Page Anti ZNF852 pAb (ATL-HPA048312)