Protein Description: zinc finger protein 843
Gene Name: ZNF843
Alternative Gene Name: MGC46336
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045179: 35%, ENSRNOG00000046607: 37%
Entrez Gene ID: 283933
Uniprot ID: Q8N446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF843
Alternative Gene Name: MGC46336
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045179: 35%, ENSRNOG00000046607: 37%
Entrez Gene ID: 283933
Uniprot ID: Q8N446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PDSTSGLRPCGSPGSFLQHLPPSTLLPRPPFLYPGPPLSLQPLVPSGLPAVPAVPLGGLEVAQVPPATQPAAQQ |
| Documents & Links for Anti ZNF843 pAb (ATL-HPA077945) | |
| Datasheet | Anti ZNF843 pAb (ATL-HPA077945) Datasheet (External Link) |
| Vendor Page | Anti ZNF843 pAb (ATL-HPA077945) at Atlas |
| Documents & Links for Anti ZNF843 pAb (ATL-HPA077945) | |
| Datasheet | Anti ZNF843 pAb (ATL-HPA077945) Datasheet (External Link) |
| Vendor Page | Anti ZNF843 pAb (ATL-HPA077945) |