Anti ZNF843 pAb (ATL-HPA077945)

Catalog No:
ATL-HPA077945-25
$447.00
Protein Description: zinc finger protein 843
Gene Name: ZNF843
Alternative Gene Name: MGC46336
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045179: 35%, ENSRNOG00000046607: 37%
Entrez Gene ID: 283933
Uniprot ID: Q8N446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence PDSTSGLRPCGSPGSFLQHLPPSTLLPRPPFLYPGPPLSLQPLVPSGLPAVPAVPLGGLEVAQVPPATQPAAQQ
Gene ID - Mouse ENSMUSG00000045179
Gene ID - Rat ENSMUSG00000045179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ZNF843 pAb (ATL-HPA077945)
Datasheet Anti ZNF843 pAb (ATL-HPA077945) Datasheet (External Link)
Vendor Page Anti ZNF843 pAb (ATL-HPA077945) at Atlas

Documents & Links for Anti ZNF843 pAb (ATL-HPA077945)
Datasheet Anti ZNF843 pAb (ATL-HPA077945) Datasheet (External Link)
Vendor Page Anti ZNF843 pAb (ATL-HPA077945)