Anti ZNF835 pAb (ATL-HPA051136)

Atlas Antibodies

SKU:
ATL-HPA051136-25
  • Immunohistochemical staining of human uterus, post-menopause shows strong cytoplasmic positivity in a subset of glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 835
Gene Name: ZNF835
Alternative Gene Name: BC37295_3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061723: 26%, ENSRNOG00000042465: 26%
Entrez Gene ID: 90485
Uniprot ID: Q9Y2P0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQGAELEGNWKHEGQVEDLQENQESCPEPEAVACKGDPAGDSMQERDEFSRIPRTISSPAATQASVPDDSSSRR
Gene Sequence LQGAELEGNWKHEGQVEDLQENQESCPEPEAVACKGDPAGDSMQERDEFSRIPRTISSPAATQASVPDDSSSRR
Gene ID - Mouse ENSMUSG00000061723
Gene ID - Rat ENSRNOG00000042465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF835 pAb (ATL-HPA051136)
Datasheet Anti ZNF835 pAb (ATL-HPA051136) Datasheet (External Link)
Vendor Page Anti ZNF835 pAb (ATL-HPA051136) at Atlas Antibodies

Documents & Links for Anti ZNF835 pAb (ATL-HPA051136)
Datasheet Anti ZNF835 pAb (ATL-HPA051136) Datasheet (External Link)
Vendor Page Anti ZNF835 pAb (ATL-HPA051136)