Anti ZNF800 pAb (ATL-HPA052194)

Atlas Antibodies

SKU:
ATL-HPA052194-100
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 800
Gene Name: ZNF800
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039841: 97%, ENSRNOG00000007662: 98%
Entrez Gene ID: 168850
Uniprot ID: Q2TB10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRHITVVHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPSRDEAKHSDSKHDGTSNSPSKKYEVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHKKTHKANASNSPEGNKTK
Gene Sequence IRHITVVHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPSRDEAKHSDSKHDGTSNSPSKKYEVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHKKTHKANASNSPEGNKTK
Gene ID - Mouse ENSMUSG00000039841
Gene ID - Rat ENSRNOG00000007662
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF800 pAb (ATL-HPA052194)
Datasheet Anti ZNF800 pAb (ATL-HPA052194) Datasheet (External Link)
Vendor Page Anti ZNF800 pAb (ATL-HPA052194) at Atlas Antibodies

Documents & Links for Anti ZNF800 pAb (ATL-HPA052194)
Datasheet Anti ZNF800 pAb (ATL-HPA052194) Datasheet (External Link)
Vendor Page Anti ZNF800 pAb (ATL-HPA052194)