Anti ZNF786 pAb (ATL-HPA053459)

Atlas Antibodies

SKU:
ATL-HPA053459-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 786
Gene Name: ZNF786
Alternative Gene Name: DKFZp762I137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051499: 33%, ENSRNOG00000006925: 34%
Entrez Gene ID: 136051
Uniprot ID: Q8N393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NADGEMCFRHELTHPSHRLPQQGEKPAQCTPCGKRSLPVDSTQARRCQHSREGPASWREGRGASSSVHSGQKPGSRLPQEGNSHQEG
Gene Sequence NADGEMCFRHELTHPSHRLPQQGEKPAQCTPCGKRSLPVDSTQARRCQHSREGPASWREGRGASSSVHSGQKPGSRLPQEGNSHQEG
Gene ID - Mouse ENSMUSG00000051499
Gene ID - Rat ENSRNOG00000006925
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF786 pAb (ATL-HPA053459)
Datasheet Anti ZNF786 pAb (ATL-HPA053459) Datasheet (External Link)
Vendor Page Anti ZNF786 pAb (ATL-HPA053459) at Atlas Antibodies

Documents & Links for Anti ZNF786 pAb (ATL-HPA053459)
Datasheet Anti ZNF786 pAb (ATL-HPA053459) Datasheet (External Link)
Vendor Page Anti ZNF786 pAb (ATL-HPA053459)