Protein Description: zinc finger protein 721
Gene Name: ZNF721
Alternative Gene Name: KIAA1982
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044014: 33%, ENSRNOG00000014172: 33%
Entrez Gene ID: 170960
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF721
Alternative Gene Name: KIAA1982
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044014: 33%, ENSRNOG00000014172: 33%
Entrez Gene ID: 170960
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSLISSCRVISHGLSRGRNRATEKNDLLTTEEPVVKHRFDLQYPEEMWRNTVVQKGR |
Documents & Links for Anti ZNF721 pAb (ATL-HPA065313) | |
Datasheet | Anti ZNF721 pAb (ATL-HPA065313) Datasheet (External Link) |
Vendor Page | Anti ZNF721 pAb (ATL-HPA065313) at Atlas |
Documents & Links for Anti ZNF721 pAb (ATL-HPA065313) | |
Datasheet | Anti ZNF721 pAb (ATL-HPA065313) Datasheet (External Link) |
Vendor Page | Anti ZNF721 pAb (ATL-HPA065313) |