Anti ZNF688 pAb (ATL-HPA048922 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048922-25

• 
• 
• 

Protein Description: zinc finger protein 688
Gene Name: ZNF688
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045251: 40%, ENSRNOG00000028569: 33%
Entrez Gene ID: 146542
Uniprot ID: P0C7X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQ
• Gene Sequence: GERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQ
• Gene ID - Mouse: ENSMUSG00000045251
• Gene ID - Rat: ENSRNOG00000028569
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.