Anti ZNF671 pAb (ATL-HPA046099)

Atlas Antibodies

SKU:
ATL-HPA046099-25
  • Immunohistochemical staining of human tonsil shows strong membranous positivity in germinal and non-germinal center cells .
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 671
Gene Name: ZNF671
Alternative Gene Name: FLJ23506
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024642: 35%, ENSRNOG00000005882: 35%
Entrez Gene ID: 79891
Uniprot ID: Q8TAW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FWFSTDFDQHQNQPNGGKLFPRKEGRDSVKSCRVHVPEKTLTCGKGRRDF
Gene Sequence FWFSTDFDQHQNQPNGGKLFPRKEGRDSVKSCRVHVPEKTLTCGKGRRDF
Gene ID - Mouse ENSMUSG00000024642
Gene ID - Rat ENSRNOG00000005882
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF671 pAb (ATL-HPA046099)
Datasheet Anti ZNF671 pAb (ATL-HPA046099) Datasheet (External Link)
Vendor Page Anti ZNF671 pAb (ATL-HPA046099) at Atlas Antibodies

Documents & Links for Anti ZNF671 pAb (ATL-HPA046099)
Datasheet Anti ZNF671 pAb (ATL-HPA046099) Datasheet (External Link)
Vendor Page Anti ZNF671 pAb (ATL-HPA046099)



Citations for Anti ZNF671 pAb (ATL-HPA046099) – 1 Found
Mase, Shoko; Shinjo, Keiko; Totani, Haruhito; Katsushima, Keisuke; Arakawa, Atsushi; Takahashi, Satoru; Lai, Hung-Cheng; Lin, Ru-Inn; Chan, Michael W Y; Sugiura-Ogasawara, Mayumi; Kondo, Yutaka. ZNF671 DNA methylation as a molecular predictor for the early recurrence of serous ovarian cancer. Cancer Science. 2019;110(3):1105-1116.  PubMed