Anti ZNF667 pAb (ATL-HPA046673)

Atlas Antibodies

SKU:
ATL-HPA046673-25
  • Immunohistochemical staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 667
Gene Name: ZNF667
Alternative Gene Name: FLJ14011
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054893: 66%, ENSRNOG00000033906: 70%
Entrez Gene ID: 63934
Uniprot ID: Q5HYK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGK
Gene Sequence APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGK
Gene ID - Mouse ENSMUSG00000054893
Gene ID - Rat ENSRNOG00000033906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF667 pAb (ATL-HPA046673)
Datasheet Anti ZNF667 pAb (ATL-HPA046673) Datasheet (External Link)
Vendor Page Anti ZNF667 pAb (ATL-HPA046673) at Atlas Antibodies

Documents & Links for Anti ZNF667 pAb (ATL-HPA046673)
Datasheet Anti ZNF667 pAb (ATL-HPA046673) Datasheet (External Link)
Vendor Page Anti ZNF667 pAb (ATL-HPA046673)