Anti ZNF667 pAb (ATL-HPA046673)
Atlas Antibodies
- SKU:
- ATL-HPA046673-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF667
Alternative Gene Name: FLJ14011
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054893: 66%, ENSRNOG00000033906: 70%
Entrez Gene ID: 63934
Uniprot ID: Q5HYK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGK |
Gene Sequence | APWMVEPVRRRRAPDSGSKCETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGK |
Gene ID - Mouse | ENSMUSG00000054893 |
Gene ID - Rat | ENSRNOG00000033906 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF667 pAb (ATL-HPA046673) | |
Datasheet | Anti ZNF667 pAb (ATL-HPA046673) Datasheet (External Link) |
Vendor Page | Anti ZNF667 pAb (ATL-HPA046673) at Atlas Antibodies |
Documents & Links for Anti ZNF667 pAb (ATL-HPA046673) | |
Datasheet | Anti ZNF667 pAb (ATL-HPA046673) Datasheet (External Link) |
Vendor Page | Anti ZNF667 pAb (ATL-HPA046673) |