Anti ZNF658 pAb (ATL-HPA048668)

Atlas Antibodies

SKU: ATL-HPA048668-25

• 
• 

Protein Description: zinc finger protein 658
Gene Name: ZNF658
Alternative Gene Name: DKFZp572C163, FLJ32813, MGC35232
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029587: 39%, ENSRNOG00000006958: 39%
Entrez Gene ID: 26149
Uniprot ID: Q5TYW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGINFSRKS
• Gene Sequence: GKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGINFSRKS
• Gene ID - Mouse: ENSMUSG00000029587
• Gene ID - Rat: ENSRNOG00000006958
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.