Anti ZNF655 pAb (ATL-HPA050750)

Atlas Antibodies

SKU:
ATL-HPA050750-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 655
Gene Name: ZNF655
Alternative Gene Name: VIK, VIK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007812: 55%, ENSRNOG00000060129: 56%
Entrez Gene ID: 79027
Uniprot ID: Q8N720
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYKVRV
Gene Sequence MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYKVRV
Gene ID - Mouse ENSMUSG00000007812
Gene ID - Rat ENSRNOG00000060129
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF655 pAb (ATL-HPA050750)
Datasheet Anti ZNF655 pAb (ATL-HPA050750) Datasheet (External Link)
Vendor Page Anti ZNF655 pAb (ATL-HPA050750) at Atlas Antibodies

Documents & Links for Anti ZNF655 pAb (ATL-HPA050750)
Datasheet Anti ZNF655 pAb (ATL-HPA050750) Datasheet (External Link)
Vendor Page Anti ZNF655 pAb (ATL-HPA050750)