Anti ZNF648 pAb (ATL-HPA053897)

Atlas Antibodies

SKU:
ATL-HPA053897-25
  • Immunohistochemical staining of human duodenum shows strong luminal membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 648
Gene Name: ZNF648
Alternative Gene Name: FLJ46813
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066797: 41%, ENSRNOG00000031569: 38%
Entrez Gene ID: 127665
Uniprot ID: Q5T619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVPPSFPSNGKYLCAHKSVDTSAGNSSLLCFPRPGSNWDLPTQETHTPAQASATPASLAAAVLAKARNSRKVQ
Gene Sequence DVPPSFPSNGKYLCAHKSVDTSAGNSSLLCFPRPGSNWDLPTQETHTPAQASATPASLAAAVLAKARNSRKVQ
Gene ID - Mouse ENSMUSG00000066797
Gene ID - Rat ENSRNOG00000031569
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF648 pAb (ATL-HPA053897)
Datasheet Anti ZNF648 pAb (ATL-HPA053897) Datasheet (External Link)
Vendor Page Anti ZNF648 pAb (ATL-HPA053897) at Atlas Antibodies

Documents & Links for Anti ZNF648 pAb (ATL-HPA053897)
Datasheet Anti ZNF648 pAb (ATL-HPA053897) Datasheet (External Link)
Vendor Page Anti ZNF648 pAb (ATL-HPA053897)