Anti ZNF615 pAb (ATL-HPA052422)

Atlas Antibodies

SKU:
ATL-HPA052422-25
  • Immunohistochemical staining of human stomach, upper shows strong granular cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 615
Gene Name: ZNF615
Alternative Gene Name: FLJ33710
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039701: 27%, ENSRNOG00000016847: 26%
Entrez Gene ID: 284370
Uniprot ID: Q8N8J6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LERGEETCTTEDEIYSRICSDSGGASGGAYAEIRKIDDPLQHHLQNQSIQKSVKQCHEQNMFGNIVNQNKGHFLLKQD
Gene Sequence LERGEETCTTEDEIYSRICSDSGGASGGAYAEIRKIDDPLQHHLQNQSIQKSVKQCHEQNMFGNIVNQNKGHFLLKQD
Gene ID - Mouse ENSMUSG00000039701
Gene ID - Rat ENSRNOG00000016847
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF615 pAb (ATL-HPA052422)
Datasheet Anti ZNF615 pAb (ATL-HPA052422) Datasheet (External Link)
Vendor Page Anti ZNF615 pAb (ATL-HPA052422) at Atlas Antibodies

Documents & Links for Anti ZNF615 pAb (ATL-HPA052422)
Datasheet Anti ZNF615 pAb (ATL-HPA052422) Datasheet (External Link)
Vendor Page Anti ZNF615 pAb (ATL-HPA052422)