Anti ZNF607 pAb (ATL-HPA055018)

Atlas Antibodies

SKU: ATL-HPA055018-25

• 
• 

Protein Description: zinc finger protein 607
Gene Name: ZNF607
Alternative Gene Name: FLJ14802, MGC13071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046311: 33%, ENSRNOG00000020087: 35%
Entrez Gene ID: 84775
Uniprot ID: Q96SK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVREETRGECTDLDSRCEIISDGKMQLYRKHSCVTLHQRIHNG
• Gene Sequence: IVREETRGECTDLDSRCEIISDGKMQLYRKHSCVTLHQRIHNG
• Gene ID - Mouse: ENSMUSG00000046311
• Gene ID - Rat: ENSRNOG00000020087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.