Anti ZNF596 pAb (ATL-HPA055463 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055463-25

• 
• 
• 

Protein Description: zinc finger protein 596
Gene Name: ZNF596
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030443: 27%, ENSRNOG00000034184: 30%
Entrez Gene ID: 169270
Uniprot ID: Q8TC21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVSIGKQLCKSVVLSQLEQVEKLSTQRISLLQGREVGIKHQEIPFIQHIYQKGTSTISTMRSHTQEDP
• Gene Sequence: LVSIGKQLCKSVVLSQLEQVEKLSTQRISLLQGREVGIKHQEIPFIQHIYQKGTSTISTMRSHTQEDP
• Gene ID - Mouse: ENSMUSG00000030443
• Gene ID - Rat: ENSRNOG00000034184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.