Anti ZNF577 pAb (ATL-HPA046761)

Atlas Antibodies

SKU:
ATL-HPA046761-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 577
Gene Name: ZNF577
Alternative Gene Name: MGC4400
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049421: 28%, ENSRNOG00000046629: 29%
Entrez Gene ID: 84765
Uniprot ID: Q9BSK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGIAEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLHIKRDKTLTGVKYHRCVKPSSPKSQLNDLQKICAGGKPH
Gene Sequence PGIAEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLHIKRDKTLTGVKYHRCVKPSSPKSQLNDLQKICAGGKPH
Gene ID - Mouse ENSMUSG00000049421
Gene ID - Rat ENSRNOG00000046629
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF577 pAb (ATL-HPA046761)
Datasheet Anti ZNF577 pAb (ATL-HPA046761) Datasheet (External Link)
Vendor Page Anti ZNF577 pAb (ATL-HPA046761) at Atlas Antibodies

Documents & Links for Anti ZNF577 pAb (ATL-HPA046761)
Datasheet Anti ZNF577 pAb (ATL-HPA046761) Datasheet (External Link)
Vendor Page Anti ZNF577 pAb (ATL-HPA046761)