Anti ZNF569 pAb (ATL-HPA052994)

Atlas Antibodies

SKU:
ATL-HPA052994-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, the Golgi apparatus & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 569
Gene Name: ZNF569
Alternative Gene Name: FLJ32053, ZAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059975: 38%, ENSRNOG00000048894: 44%
Entrez Gene ID: 148266
Uniprot ID: Q5MCW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSHFVIT
Gene Sequence EIWGVDEHQKNQDRLLRQVEVKFQKTLTEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNVKCLMRKEHCEYNEPVKSYGNSSSHFVIT
Gene ID - Mouse ENSMUSG00000059975
Gene ID - Rat ENSRNOG00000048894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF569 pAb (ATL-HPA052994)
Datasheet Anti ZNF569 pAb (ATL-HPA052994) Datasheet (External Link)
Vendor Page Anti ZNF569 pAb (ATL-HPA052994) at Atlas Antibodies

Documents & Links for Anti ZNF569 pAb (ATL-HPA052994)
Datasheet Anti ZNF569 pAb (ATL-HPA052994) Datasheet (External Link)
Vendor Page Anti ZNF569 pAb (ATL-HPA052994)