Anti ZNF568 pAb (ATL-HPA052061)

Atlas Antibodies

SKU:
ATL-HPA052061-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 568
Gene Name: ZNF568
Alternative Gene Name: DKFZp686B0797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078435: 36%, ENSRNOG00000056374: 36%
Entrez Gene ID: 374900
Uniprot ID: Q3ZCX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRHER
Gene Sequence KGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRHER
Gene ID - Mouse ENSMUSG00000078435
Gene ID - Rat ENSRNOG00000056374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF568 pAb (ATL-HPA052061)
Datasheet Anti ZNF568 pAb (ATL-HPA052061) Datasheet (External Link)
Vendor Page Anti ZNF568 pAb (ATL-HPA052061) at Atlas Antibodies

Documents & Links for Anti ZNF568 pAb (ATL-HPA052061)
Datasheet Anti ZNF568 pAb (ATL-HPA052061) Datasheet (External Link)
Vendor Page Anti ZNF568 pAb (ATL-HPA052061)