Anti ZNF561 pAb (ATL-HPA055332)
Atlas Antibodies
- SKU:
- ATL-HPA055332-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF561
Alternative Gene Name: MGC45408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060510: 44%, ENSRNOG00000034037: 44%
Entrez Gene ID: 93134
Uniprot ID: Q8N587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SVHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLN |
Gene Sequence | SVHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLN |
Gene ID - Mouse | ENSMUSG00000060510 |
Gene ID - Rat | ENSRNOG00000034037 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF561 pAb (ATL-HPA055332) | |
Datasheet | Anti ZNF561 pAb (ATL-HPA055332) Datasheet (External Link) |
Vendor Page | Anti ZNF561 pAb (ATL-HPA055332) at Atlas Antibodies |
Documents & Links for Anti ZNF561 pAb (ATL-HPA055332) | |
Datasheet | Anti ZNF561 pAb (ATL-HPA055332) Datasheet (External Link) |
Vendor Page | Anti ZNF561 pAb (ATL-HPA055332) |