Anti ZNF559 pAb (ATL-HPA059632)

Atlas Antibodies

SKU:
ATL-HPA059632-25
  • Immunohistochemical staining of human ovary shows strong nuclear positivity in ovarian stroma cells.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 559
Gene Name: ZNF559
Alternative Gene Name: MGC13105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059475: 40%, ENSRNOG00000020356: 40%
Entrez Gene ID: 84527
Uniprot ID: Q9BR84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVAVDWESHINTKWSAPQQNFLQGKTSSVVEMERNHFGEELFDFNQCEKALSEHS
Gene Sequence LVAVDWESHINTKWSAPQQNFLQGKTSSVVEMERNHFGEELFDFNQCEKALSEHS
Gene ID - Mouse ENSMUSG00000059475
Gene ID - Rat ENSRNOG00000020356
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF559 pAb (ATL-HPA059632)
Datasheet Anti ZNF559 pAb (ATL-HPA059632) Datasheet (External Link)
Vendor Page Anti ZNF559 pAb (ATL-HPA059632) at Atlas Antibodies

Documents & Links for Anti ZNF559 pAb (ATL-HPA059632)
Datasheet Anti ZNF559 pAb (ATL-HPA059632) Datasheet (External Link)
Vendor Page Anti ZNF559 pAb (ATL-HPA059632)