Anti ZNF530 pAb (ATL-HPA045868)

Atlas Antibodies

SKU:
ATL-HPA045868-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 530
Gene Name: ZNF530
Alternative Gene Name: KIAA1508
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074283: 33%, ENSRNOG00000030308: 33%
Entrez Gene ID: 348327
Uniprot ID: Q6P9A1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQMIELHASPCGQKLYLGGASRDFWMSSNLHQLQKLDNGEKLFKVDGDQASFMMNCRFHVSGKPFTFGEVGRDF
Gene Sequence LQMIELHASPCGQKLYLGGASRDFWMSSNLHQLQKLDNGEKLFKVDGDQASFMMNCRFHVSGKPFTFGEVGRDF
Gene ID - Mouse ENSMUSG00000074283
Gene ID - Rat ENSRNOG00000030308
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF530 pAb (ATL-HPA045868)
Datasheet Anti ZNF530 pAb (ATL-HPA045868) Datasheet (External Link)
Vendor Page Anti ZNF530 pAb (ATL-HPA045868) at Atlas Antibodies

Documents & Links for Anti ZNF530 pAb (ATL-HPA045868)
Datasheet Anti ZNF530 pAb (ATL-HPA045868) Datasheet (External Link)
Vendor Page Anti ZNF530 pAb (ATL-HPA045868)