Anti ZNF526 pAb (ATL-HPA056609)

Atlas Antibodies

SKU:
ATL-HPA056609-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 526
Gene Name: ZNF526
Alternative Gene Name: KIAA1951, MGC4267
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046541: 79%, ENSRNOG00000047526: 79%
Entrez Gene ID: 116115
Uniprot ID: Q8TF50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAV
Gene Sequence AEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAV
Gene ID - Mouse ENSMUSG00000046541
Gene ID - Rat ENSRNOG00000047526
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF526 pAb (ATL-HPA056609)
Datasheet Anti ZNF526 pAb (ATL-HPA056609) Datasheet (External Link)
Vendor Page Anti ZNF526 pAb (ATL-HPA056609) at Atlas Antibodies

Documents & Links for Anti ZNF526 pAb (ATL-HPA056609)
Datasheet Anti ZNF526 pAb (ATL-HPA056609) Datasheet (External Link)
Vendor Page Anti ZNF526 pAb (ATL-HPA056609)