Anti ZNF524 pAb (ATL-HPA050981 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050981-25

• 
• 
• 

Protein Description: zinc finger protein 524
Gene Name: ZNF524
Alternative Gene Name: MGC23143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051184: 64%, ENSRNOG00000016565: 62%
Entrez Gene ID: 147807
Uniprot ID: Q96C55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATA
• Gene Sequence: CRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATA
• Gene ID - Mouse: ENSMUSG00000051184
• Gene ID - Rat: ENSRNOG00000016565
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.