Anti ZNF497 pAb (ATL-HPA047872)

Atlas Antibodies

SKU:
ATL-HPA047872-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cell junctions.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 497
Gene Name: ZNF497
Alternative Gene Name: FLJ44773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063663: 30%, ENSRNOG00000060662: 33%
Entrez Gene ID: 162968
Uniprot ID: Q6ZNH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRAL
Gene Sequence PEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRAL
Gene ID - Mouse ENSMUSG00000063663
Gene ID - Rat ENSRNOG00000060662
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF497 pAb (ATL-HPA047872)
Datasheet Anti ZNF497 pAb (ATL-HPA047872) Datasheet (External Link)
Vendor Page Anti ZNF497 pAb (ATL-HPA047872) at Atlas Antibodies

Documents & Links for Anti ZNF497 pAb (ATL-HPA047872)
Datasheet Anti ZNF497 pAb (ATL-HPA047872) Datasheet (External Link)
Vendor Page Anti ZNF497 pAb (ATL-HPA047872)