Protein Description: zinc finger protein 432
Gene Name: ZNF432
Alternative Gene Name: KIAA0798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034751: 27%, ENSRNOG00000024508: 31%
Entrez Gene ID: 9668
Uniprot ID: O94892
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF432
Alternative Gene Name: KIAA0798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034751: 27%, ENSRNOG00000024508: 31%
Entrez Gene ID: 9668
Uniprot ID: O94892
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSLCLFRENHDT |
| Documents & Links for Anti ZNF432 pAb (ATL-HPA065606) | |
| Datasheet | Anti ZNF432 pAb (ATL-HPA065606) Datasheet (External Link) |
| Vendor Page | Anti ZNF432 pAb (ATL-HPA065606) at Atlas |
| Documents & Links for Anti ZNF432 pAb (ATL-HPA065606) | |
| Datasheet | Anti ZNF432 pAb (ATL-HPA065606) Datasheet (External Link) |
| Vendor Page | Anti ZNF432 pAb (ATL-HPA065606) |