Protein Description: zinc finger protein 404
Gene Name: ZNF404
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020420: 29%, ENSRNOG00000001141: 28%
Entrez Gene ID: 342908
Uniprot ID: Q494X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF404
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020420: 29%, ENSRNOG00000001141: 28%
Entrez Gene ID: 342908
Uniprot ID: Q494X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VSLDFNFTTESNKLSSEKRNYEVNAYHQETWKRNKTFNLMRFIFRTDPQYTI |
Documents & Links for Anti ZNF404 pAb (ATL-HPA063607) | |
Datasheet | Anti ZNF404 pAb (ATL-HPA063607) Datasheet (External Link) |
Vendor Page | Anti ZNF404 pAb (ATL-HPA063607) at Atlas |
Documents & Links for Anti ZNF404 pAb (ATL-HPA063607) | |
Datasheet | Anti ZNF404 pAb (ATL-HPA063607) Datasheet (External Link) |
Vendor Page | Anti ZNF404 pAb (ATL-HPA063607) |