![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101601/181739/atl-hpa076275_anti-znf395-pab-atl-hpa076275_63407__99343.1681138133.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: zinc finger protein 395
Gene Name: ZNF395
Alternative Gene Name: DKFZp434K1210, HDBP2, PBF, PRF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034522: 92%, ENSRNOG00000014191: 88%
Entrez Gene ID: 55893
Uniprot ID: Q9H8N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF395
Alternative Gene Name: DKFZp434K1210, HDBP2, PBF, PRF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034522: 92%, ENSRNOG00000014191: 88%
Entrez Gene ID: 55893
Uniprot ID: Q9H8N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA |
| Documents & Links for Anti ZNF395 pAb (ATL-HPA076275) | |
| Datasheet | Anti ZNF395 pAb (ATL-HPA076275) Datasheet (External Link) |
| Vendor Page | Anti ZNF395 pAb (ATL-HPA076275) at Atlas |
| Documents & Links for Anti ZNF395 pAb (ATL-HPA076275) | |
| Datasheet | Anti ZNF395 pAb (ATL-HPA076275) Datasheet (External Link) |
| Vendor Page | Anti ZNF395 pAb (ATL-HPA076275) |