Anti ZNF385B pAb (ATL-HPA046086)

Atlas Antibodies

SKU:
ATL-HPA046086-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 385B
Gene Name: ZNF385B
Alternative Gene Name: FLJ25270, ZNF533
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027016: 88%, ENSRNOG00000019065: 87%
Entrez Gene ID: 151126
Uniprot ID: Q569K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP
Gene Sequence GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP
Gene ID - Mouse ENSMUSG00000027016
Gene ID - Rat ENSRNOG00000019065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF385B pAb (ATL-HPA046086)
Datasheet Anti ZNF385B pAb (ATL-HPA046086) Datasheet (External Link)
Vendor Page Anti ZNF385B pAb (ATL-HPA046086) at Atlas Antibodies

Documents & Links for Anti ZNF385B pAb (ATL-HPA046086)
Datasheet Anti ZNF385B pAb (ATL-HPA046086) Datasheet (External Link)
Vendor Page Anti ZNF385B pAb (ATL-HPA046086)