Anti ZNF382 pAb (ATL-HPA049259)
Atlas Antibodies
- SKU:
- ATL-HPA049259-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZNF382
Alternative Gene Name: FLJ14686, KS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074220: 60%, ENSRNOG00000020777: 64%
Entrez Gene ID: 84911
Uniprot ID: Q96SR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PEQPFDHNECEKSFLMKGMLFTHTRAHRGERTFEYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKPV |
Gene Sequence | PEQPFDHNECEKSFLMKGMLFTHTRAHRGERTFEYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRKPV |
Gene ID - Mouse | ENSMUSG00000074220 |
Gene ID - Rat | ENSRNOG00000020777 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF382 pAb (ATL-HPA049259) | |
Datasheet | Anti ZNF382 pAb (ATL-HPA049259) Datasheet (External Link) |
Vendor Page | Anti ZNF382 pAb (ATL-HPA049259) at Atlas Antibodies |
Documents & Links for Anti ZNF382 pAb (ATL-HPA049259) | |
Datasheet | Anti ZNF382 pAb (ATL-HPA049259) Datasheet (External Link) |
Vendor Page | Anti ZNF382 pAb (ATL-HPA049259) |
Citations for Anti ZNF382 pAb (ATL-HPA049259) – 1 Found |
Pei, Lijiao; He, Xiaoqian; Li, Shuman; Sun, Ran; Xiang, Qin; Ren, Guosheng; Xiang, Tingxiu. KRAB zinc-finger protein 382 regulates epithelial-mesenchymal transition and functions as a tumor suppressor, but is silenced by CpG methylation in gastric cancer. International Journal Of Oncology. 2018;53(3):961-972. PubMed |