Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052446-25

• 
• 
• 

Protein Description: zinc finger protein 365
Gene Name: ZNF365
Alternative Gene Name: KIAA0844, UAN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037855: 92%, ENSRNOG00000000638: 93%
Entrez Gene ID: 22891
Uniprot ID: Q70YC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMI
• Gene Sequence: RSGPGLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVAVEMI
• Gene ID - Mouse: ENSMUSG00000037855
• Gene ID - Rat: ENSRNOG00000000638
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF365 pAb (ATL-HPA052446 w/enhanced validation) – 1 Found

Wang, Chan; Liu, Shuiping; Kuang, Yeye; Hu, Xiaotong; Fang, Xiao. Downregulation of ZNF365 by methylation predicts poor prognosis in patients with colorectal cancer by decreasing phospho-p53 (Ser15) expression. Oncology Letters. 2020;20(4):85.