Protein Description: zinc finger protein 358
Gene Name: ZNF358
Alternative Gene Name: FLJ10390, ZFEND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047264: 80%, ENSRNOG00000000974: 80%
Entrez Gene ID: 140467
Uniprot ID: Q9NW07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF358
Alternative Gene Name: FLJ10390, ZFEND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047264: 80%, ENSRNOG00000000974: 80%
Entrez Gene ID: 140467
Uniprot ID: Q9NW07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSSFDLDPDVIGPVPLILDPNSDTLSPGDPKVDPISSGLTATPQVLATSPAVLPAPASPPRPFSCPDC |
Documents & Links for Anti ZNF358 pAb (ATL-HPA063624) | |
Datasheet | Anti ZNF358 pAb (ATL-HPA063624) Datasheet (External Link) |
Vendor Page | Anti ZNF358 pAb (ATL-HPA063624) at Atlas |
Documents & Links for Anti ZNF358 pAb (ATL-HPA063624) | |
Datasheet | Anti ZNF358 pAb (ATL-HPA063624) Datasheet (External Link) |
Vendor Page | Anti ZNF358 pAb (ATL-HPA063624) |