Anti ZNF354A pAb (ATL-HPA052043)

Atlas Antibodies

SKU:
ATL-HPA052043-25
  • Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, nucleoli & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 354A
Gene Name: ZNF354A
Alternative Gene Name: EZNF, HKL1, KID-1, KID1, TCF17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020364: 40%, ENSRNOG00000003634: 40%
Entrez Gene ID: 6940
Uniprot ID: O60765
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR
Gene Sequence TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR
Gene ID - Mouse ENSMUSG00000020364
Gene ID - Rat ENSRNOG00000003634
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF354A pAb (ATL-HPA052043)
Datasheet Anti ZNF354A pAb (ATL-HPA052043) Datasheet (External Link)
Vendor Page Anti ZNF354A pAb (ATL-HPA052043) at Atlas Antibodies

Documents & Links for Anti ZNF354A pAb (ATL-HPA052043)
Datasheet Anti ZNF354A pAb (ATL-HPA052043) Datasheet (External Link)
Vendor Page Anti ZNF354A pAb (ATL-HPA052043)