Anti ZNF35 pAb (ATL-HPA054738 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054738-25
  • Immunohistochemical staining of human testis shows nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ZNF35 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418712).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 35
Gene Name: ZNF35
Alternative Gene Name: HF.10, HF10, Zfp105
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057895: 61%, ENSRNOG00000032919: 70%
Entrez Gene ID: 7584
Uniprot ID: P13682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQEAPAASTLGSYSLPGTLAKSEILETHGTMNFLGA
Gene Sequence QASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQEAPAASTLGSYSLPGTLAKSEILETHGTMNFLGA
Gene ID - Mouse ENSMUSG00000057895
Gene ID - Rat ENSRNOG00000032919
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF35 pAb (ATL-HPA054738 w/enhanced validation)
Datasheet Anti ZNF35 pAb (ATL-HPA054738 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF35 pAb (ATL-HPA054738 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ZNF35 pAb (ATL-HPA054738 w/enhanced validation)
Datasheet Anti ZNF35 pAb (ATL-HPA054738 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF35 pAb (ATL-HPA054738 w/enhanced validation)