Anti ZNF33A pAb (ATL-HPA056638)

Atlas Antibodies

SKU: ATL-HPA056638-25

• 

Protein Description: zinc finger protein 33A
Gene Name: ZNF33A
Alternative Gene Name: FLJ23404, KIAA0065, KOX31, KOX5, ZNF11A, ZNF33, ZZAPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030145: 35%, ENSRNOG00000000599: 34%
Entrez Gene ID: 7581
Uniprot ID: Q06730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VWTADHLKERSQENQSKHLWEVVFINNEMLTKEQ
• Gene Sequence: VWTADHLKERSQENQSKHLWEVVFINNEMLTKEQ
• Gene ID - Mouse: ENSMUSG00000030145
• Gene ID - Rat: ENSRNOG00000000599
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.