Protein Description: zinc finger protein 331
Gene Name: ZNF331
Alternative Gene Name: RITA, ZNF361, ZNF463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028809: 31%, ENSRNOG00000018194: 31%
Entrez Gene ID: 55422
Uniprot ID: Q9NQX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF331
Alternative Gene Name: RITA, ZNF361, ZNF463
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028809: 31%, ENSRNOG00000018194: 31%
Entrez Gene ID: 55422
Uniprot ID: Q9NQX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSF |
Documents & Links for Anti ZNF331 pAb (ATL-HPA063157) | |
Datasheet | Anti ZNF331 pAb (ATL-HPA063157) Datasheet (External Link) |
Vendor Page | Anti ZNF331 pAb (ATL-HPA063157) at Atlas |
Documents & Links for Anti ZNF331 pAb (ATL-HPA063157) | |
Datasheet | Anti ZNF331 pAb (ATL-HPA063157) Datasheet (External Link) |
Vendor Page | Anti ZNF331 pAb (ATL-HPA063157) |