Anti ZNF304 pAb (ATL-HPA050531)

Atlas Antibodies

SKU:
ATL-HPA050531-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 304
Gene Name: ZNF304
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047371: 43%, ENSRNOG00000029490: 43%
Entrez Gene ID: 57343
Uniprot ID: Q9HCX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLRQHQGDYDGQMLFSCGDEGKAFLDTFTLLDSQMTHAEVRPFRCLPCGNVFKEKS
Gene Sequence SLRQHQGDYDGQMLFSCGDEGKAFLDTFTLLDSQMTHAEVRPFRCLPCGNVFKEKS
Gene ID - Mouse ENSMUSG00000047371
Gene ID - Rat ENSRNOG00000029490
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF304 pAb (ATL-HPA050531)
Datasheet Anti ZNF304 pAb (ATL-HPA050531) Datasheet (External Link)
Vendor Page Anti ZNF304 pAb (ATL-HPA050531) at Atlas Antibodies

Documents & Links for Anti ZNF304 pAb (ATL-HPA050531)
Datasheet Anti ZNF304 pAb (ATL-HPA050531) Datasheet (External Link)
Vendor Page Anti ZNF304 pAb (ATL-HPA050531)



Citations for Anti ZNF304 pAb (ATL-HPA050531) – 1 Found
Ren, Li-Xin; Zeng, Bo-Wen; Zhu, Meng; Zhao, An-Ning; Shi, Bei; Zhang, Hong; Wang, Dan-Dan; Gu, Jun-Fei; Yang, Zhan. A Novel ZNF304/miR-183-5p/FOXO4 Pathway Regulates Cell Proliferation in Clear Cell Renal Carcinoma. Frontiers In Oncology. 11( 34692488):710525.  PubMed
!