Anti ZNF296 pAb (ATL-HPA049576)

Atlas Antibodies

SKU:
ATL-HPA049576-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & centrosome.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 296
Gene Name: ZNF296
Alternative Gene Name: ZNF342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011267: 36%, ENSRNOG00000049605: 47%
Entrez Gene ID: 162979
Uniprot ID: Q8WUU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDAQPQQAPRLGPFSPKEVSS
Gene Sequence MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDAQPQQAPRLGPFSPKEVSS
Gene ID - Mouse ENSMUSG00000011267
Gene ID - Rat ENSRNOG00000049605
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF296 pAb (ATL-HPA049576)
Datasheet Anti ZNF296 pAb (ATL-HPA049576) Datasheet (External Link)
Vendor Page Anti ZNF296 pAb (ATL-HPA049576) at Atlas Antibodies

Documents & Links for Anti ZNF296 pAb (ATL-HPA049576)
Datasheet Anti ZNF296 pAb (ATL-HPA049576) Datasheet (External Link)
Vendor Page Anti ZNF296 pAb (ATL-HPA049576)