Anti ZNF292 pAb (ATL-HPA050618)
Atlas Antibodies
- SKU:
- ATL-HPA050618-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ZNF292
Alternative Gene Name: bA393I2.3, KIAA0530, ZFP292, Zn-15, Zn-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039967: 86%, ENSRNOG00000031031: 83%
Entrez Gene ID: 23036
Uniprot ID: O60281
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSLGTPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQKANNLNTPNNGKFVYFLPSPVNSSNPFFTSQTKANGNPAC |
Gene Sequence | NSLGTPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQKANNLNTPNNGKFVYFLPSPVNSSNPFFTSQTKANGNPAC |
Gene ID - Mouse | ENSMUSG00000039967 |
Gene ID - Rat | ENSRNOG00000031031 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZNF292 pAb (ATL-HPA050618) | |
Datasheet | Anti ZNF292 pAb (ATL-HPA050618) Datasheet (External Link) |
Vendor Page | Anti ZNF292 pAb (ATL-HPA050618) at Atlas Antibodies |
Documents & Links for Anti ZNF292 pAb (ATL-HPA050618) | |
Datasheet | Anti ZNF292 pAb (ATL-HPA050618) Datasheet (External Link) |
Vendor Page | Anti ZNF292 pAb (ATL-HPA050618) |