Anti ZNF285 pAb (ATL-HPA049212)

Atlas Antibodies

SKU:
ATL-HPA049212-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 285
Gene Name: ZNF285
Alternative Gene Name: ZNF285A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052675: 28%, ENSRNOG00000019416: 29%
Entrez Gene ID: 26974
Uniprot ID: Q96NJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNLQAKGLSYLSQEVLHCWQIWKQRIRDLTVSQDYIVNLQEECSPHLEDVSLSEEWAGISLQISENENYVVNAIIKNQDITAWQ
Gene Sequence LNLQAKGLSYLSQEVLHCWQIWKQRIRDLTVSQDYIVNLQEECSPHLEDVSLSEEWAGISLQISENENYVVNAIIKNQDITAWQ
Gene ID - Mouse ENSMUSG00000052675
Gene ID - Rat ENSRNOG00000019416
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZNF285 pAb (ATL-HPA049212)
Datasheet Anti ZNF285 pAb (ATL-HPA049212) Datasheet (External Link)
Vendor Page Anti ZNF285 pAb (ATL-HPA049212) at Atlas Antibodies

Documents & Links for Anti ZNF285 pAb (ATL-HPA049212)
Datasheet Anti ZNF285 pAb (ATL-HPA049212) Datasheet (External Link)
Vendor Page Anti ZNF285 pAb (ATL-HPA049212)