Anti ZNF281 pAb (ATL-HPA051228)

Atlas Antibodies

SKU: ATL-HPA051228-25

• 
• 

Protein Description: zinc finger protein 281
Gene Name: ZNF281
Alternative Gene Name: ZBP-99
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041483: 100%, ENSRNOG00000058643: 100%
Entrez Gene ID: 23528
Uniprot ID: Q9Y2X9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQ
• Gene Sequence: SSPLHNHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQ
• Gene ID - Mouse: ENSMUSG00000041483
• Gene ID - Rat: ENSRNOG00000058643
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ZNF281 pAb (ATL-HPA051228) – 2 Found

Long, Nguyen Phuoc; Jung, Kyung Hee; Yoon, Sang Jun; Anh, Nguyen Hoang; Nghi, Tran Diem; Kang, Yun Pyo; Yan, Hong Hua; Min, Jung Eun; Hong, Soon-Sun; Kwon, Sung Won. Systematic assessment of cervical cancer initiation and progression uncovers genetic panels for deep learning-based early diagnosis and proposes novel diagnostic and prognostic biomarkers. Oncotarget. 2017;8(65):109436-109456. 

Nicolai, Sara; Pieraccioli, Marco; Smirnov, Artem; Pitolli, Consuelo; Anemona, Lucia; Mauriello, Alessandro; Candi, Eleonora; Annicchiarico-Petruzzelli, Margherita; Shi, Yufang; Wang, Ying; Melino, Gerry; Raschellà, Giuseppe. ZNF281/Zfp281 is a target of miR-1 and counteracts muscle differentiation. Molecular Oncology. 2020;14(2):294-308.