Anti ZNF280C pAb (ATL-HPA055788)

Atlas Antibodies

SKU: ATL-HPA055788-25

• 

Protein Description: zinc finger protein 280C
Gene Name: ZNF280C
Alternative Gene Name: FLJ20095, SUHW3, ZNF633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038535: 39%, ENSRNOG00000055631: 38%
Entrez Gene ID: 55609
Uniprot ID: Q8ND82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLQSKLPTAPFGCAPGTSFLQVTPPTSQNTTARNPRKSNASRSKTSKLHATTSTASKVNTSKPRGRIAKSKAKPSY
• Gene Sequence: PLQSKLPTAPFGCAPGTSFLQVTPPTSQNTTARNPRKSNASRSKTSKLHATTSTASKVNTSKPRGRIAKSKAKPSY
• Gene ID - Mouse: ENSMUSG00000038535
• Gene ID - Rat: ENSRNOG00000055631
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.