Anti ZNF280C pAb (ATL-HPA051494 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051494-100
  • Immunohistochemistry analysis in human testis and liver tissues using Anti-ZNF280C antibody. Corresponding ZNF280C RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & nucleoli fibrillar center.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: zinc finger protein 280C
Gene Name: ZNF280C
Alternative Gene Name: FLJ20095, SUHW3, ZNF633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036916: 50%, ENSRNOG00000006797: 47%
Entrez Gene ID: 55609
Uniprot ID: Q8ND82
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSKSSQSSVTVENASKPDFTKNSQVGSDNSSILLFDSTQESLPPSQDIPAIFREGMKNTSYVLKHPSTSKVNSVTPKKPKTSEDV
Gene Sequence VSKSSQSSVTVENASKPDFTKNSQVGSDNSSILLFDSTQESLPPSQDIPAIFREGMKNTSYVLKHPSTSKVNSVTPKKPKTSEDV
Gene ID - Mouse ENSMUSG00000036916
Gene ID - Rat ENSRNOG00000006797
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ZNF280C pAb (ATL-HPA051494 w/enhanced validation)
Datasheet Anti ZNF280C pAb (ATL-HPA051494 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZNF280C pAb (ATL-HPA051494 w/enhanced validation)



Citations for Anti ZNF280C pAb (ATL-HPA051494 w/enhanced validation) – 1 Found
Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481.  PubMed